Recombinant Human ODF3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ODF3L1-6578H
• Product Overview: ODF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_787077) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ODF3L1 (Outer Dense Fiber Of Sperm Tails 3 Like 1) is a Protein Coding gene. An important paralog of this gene is ODF3L2.
• Molecular Mass: 31.1 kDa
• AA Sequence: MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSCTGYIDHDISMFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTLASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQMPLLLGPNTPVSRAAPCYSLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSHEVQQVTVHKPHIPAFTMGIKHSLHLCPLVIDIRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ODF3L1 outer dense fiber of sperm tails 3-like 1 [ Homo sapiens (human) ]
• Official Symbol: ODF3L1
• Synonyms: ODF3L1; outer dense fiber of sperm tails 3-like 1; outer dense fiber protein 3-like protein 1; MGC48986
• Gene ID: 161753
• mRNA Refseq: NM_175881
• Protein Refseq: NP_787077
• UniProt ID: Q8IXM7