Recombinant Human ODC1 Protein, His-tagged

• Cat.No.: ODC1-323H
• Product Overview: Recombinant Human ODC1 fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0
• Molecular Mass: 53.5kD
• AA Sequence: MASMTGGQQMGRGSMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGS
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: ODC1 ornithine decarboxylase 1 [ Homo sapiens ]
• Official Symbol: ODC1
• Synonyms: ODC1; ornithine decarboxylase 1; ornithine decarboxylase; ODC
• Gene ID: 4953
• mRNA Refseq: NM_002539
• Protein Refseq: NP_002530
• MIM: 165640
• UniProt ID: P11926