Recombinant Human OAF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OAF-1784H
• Product Overview: OAF MS Standard C13 and N15-labeled recombinant protein (NP_848602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: OAF (Out At First Homolog) is a Protein Coding gene. Diseases associated with OAF include Acute Maxillary Sinusitis and Alveolar Periostitis.
• Molecular Mass: 30.7 kDa
• AA Sequence: MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OAF out at first homolog [ Homo sapiens (human) ]
• Official Symbol: OAF
• Synonyms: OAF; OAF homolog (Drosophila); out at first protein homolog; MGC52117; HCV NS5A-transactivated protein 13 target protein 2; NS5ATP13TP2
• Gene ID: 220323
• mRNA Refseq: NM_178507
• Protein Refseq: NP_848602
• UniProt ID: Q86UD1