Recombinant Human NXPH3, His-tagged

• Cat.No.: NXPH3-157H
• Product Overview: Recombinant Human Neurexophilin-3 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln23-Gly252) of Human NXPH3 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 23-252 a.a.
• Description: Neurexophilin-3 is a secreted protein that belongs to the Neurexophilin family. The 252 amino acid Neurexophilin-3 precursor contains a 22 amino acid signal peptide, a 230 amino acid proprecursor that is likely cleaved at a basic motif, producing a 76 amino acid propeptide and a 154 amino acid mature protein. Neurexophilin-3 is selectively expressed in subplate-derived neurons in the cortex, granule cells in the vestibulocerebellum, Cajal-Retzius cells during development, with the highest leves in brain. Neurexophilin-3 may act as a signaling molecule that resembles neuropeptides that act as a ligand for alpha-neurexins.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: QDDGPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPN HSPPPSAKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFQHNATGQGNISISLVPPS KAVEFHQEQQIFIEAKASKIFNCRMGWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFK VVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSGVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: NXPH3 neurexophilin 3 [ Homo sapiens ]
• Official Symbol: NXPH3
• Synonyms: NXPH3; neurexophilin 3; neurexophilin-3; NPH3
• Gene ID: 11248
• mRNA Refseq: NM_007225
• Protein Refseq: NP_009156
• MIM: 604636
• UniProt ID: O95157
• Chromosome Location: 17q
• Function: molecular_function; receptor binding