Recombinant Human NXPH1 protein, His-tagged
Cat.No. : | NXPH1-85H |
Product Overview : | Recombinant Human NXPH1(Ala22-Gly271) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-271 a.a. |
Description : | Neurexophilin-1 (NXPH1) is a member of Neurexophilin family. NXPH1 consist of 271 amino acis. It contains a 21 amino acid signal peptide, 86 amino acid propeptide, and 164 amino acid mature protein. NXPH1 is expressed in subpopulations of neurons within the cerebral cortex, cerebellum and olfactory bulb that are thought to be inhibitory interneurons. In humans, NXPH2 and NXPH3 are most similar to NXPH1, sharing 84% and 64% aa identity within the mature region, respectively. By contrast, NXPH4 dost not bind a-neurexins. Genetic deletion of NXPH1 or NXPH3 produces no anatomical effect. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
AA Sequence : | ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQD LWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSV YFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSK TCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSGVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | NXPH1 neurexophilin 1 [ Homo sapiens ] |
Official Symbol | NXPH1 |
Synonyms | NXPH1; neurexophilin 1; neurexophilin-1; NPH1; Nbla00697; |
Gene ID | 30010 |
mRNA Refseq | NM_152745 |
Protein Refseq | NP_689958 |
MIM | 604639 |
UniProt ID | P58417 |
◆ Recombinant Proteins | ||
NXPH1-3707H | Recombinant Human NXPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NXPH1-4136R | Recombinant Rat NXPH1 Protein | +Inquiry |
Nxph1-8684M | Recombinant Mouse Nxph1 protein, His-tagged | +Inquiry |
NXPH1-4234H | Recombinant Human NXPH1 Protein (Ala22-Gly271), C-His tagged | +Inquiry |
NXPH1-056H | Active Recombinant Human Neurexophilin 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXPH1-1333MCL | Recombinant Mouse NXPH1 cell lysate | +Inquiry |
NXPH1-1936RCL | Recombinant Rat NXPH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NXPH1 Products
Required fields are marked with *
My Review for All NXPH1 Products
Required fields are marked with *
0
Inquiry Basket