Recombinant Human NUP62 protein, T7-tagged

• Cat.No.: NUP62-147H
• Product Overview: Recombinant human NUP62 (522aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• ProteinLength: 522 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFGSTSMSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPS TGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTS SQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPA APTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATT TSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQAT QVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEERE KTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVC EGRRKEQERSFRITFD
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro NUP62 mediated cytoplasmic protein nuclei transportation regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NUP62 protein-protein interaction.4. May be used as antigen for specific antibody development.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: NUP62 nucleoporin 62kDa [ Homo sapiens ]
• Official Symbol: NUP62
• Synonyms: NUP62; nucleoporin 62kDa; nucleoporin 62kD; nuclear pore glycoprotein p62; DKFZp547L134; FLJ20822; FLJ43869; IBSN; MGC841; p62; SNDI; nucleoporin Nup62; 62 kDa nucleoporin
• Gene ID: 23636
• mRNA Refseq: NM_001193357
• Protein Refseq: NP_001180286
• MIM: 605815
• UniProt ID: P37198
• Chromosome Location: 19
• Pathway: Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Disease, organism-specific biosystem; Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem
• Function: PTB domain binding; SH2 domain binding; SH2 domain binding; chromatin binding; contributes_to nucleocytoplasmic transporter activity; protein binding; receptor signaling complex scaffold activity; receptor signaling complex scaffold activity; structural c