Recombinant Human NUDT2 protein, GST-tagged

• Cat.No.: NUDT2-3664H
• Product Overview: Recombinant Human NUDT2 protein(P50583)(1-147aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-147aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.8 kDa
• AA Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NUDT2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 [ Homo sapiens ]
• Official Symbol: NUDT2
• Synonyms: NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; nudix motif 2; nucleoside diphosphate-linked moiety X motif 2; bis(5-nucleosyl)-tetraphosphatase (asymmetrical); diadenosine 5,5-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase; MGC10404
• Gene ID: 318
• mRNA Refseq: NM_001161
• Protein Refseq: NP_001152
• MIM: 602852
• UniProt ID: P50583