Recombinant Human NUDT2

Cat.No. : NUDT2-29730TH
Product Overview : Recombinant Full Length Human NUDT2 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-147; 147 amino acids, 16.8kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-147 a.a.
Description : This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified.
Form : Liquid
Purity : Immunogen affinity purified
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTP PKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLE EACQLAQFKEMKAALQEGHQFLCSIEA
Sequence Similarities : Belongs to the Nudix hydrolase family.Contains 1 nudix hydrolase domain.
Full Length : Full L.
Gene Name NUDT2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 [ Homo sapiens ]
Official Symbol NUDT2
Synonyms NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohyd
Gene ID 318
mRNA Refseq NM_001161
Protein Refseq NP_001152
MIM 602852
Uniprot ID P50583
Chromosome Location 9p13
Pathway Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function GTP binding; bis(5-nucleosyl)-tetraphosphatase (asymmetrical) activity; bis(5-nucleosyl)-tetraphosphatase (symmetrical) activity; hydrolase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NUDT2 Products

Required fields are marked with *

My Review for All NUDT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon