Recombinant Human NUDT16L1, His-tagged

• Cat.No.: NUDT16L1-31391TH
• Product Overview: Recombinant full length Human SDOS with an N terminal His tag; 231aa, 25.5kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 211 amino acids
• Description: NUDT16L1, also known Syndesmos, is a cytoplasmic protein that interacts specifically with the cytoplasmic domain of syndecan-4, and it co-localizes with syndecan-4 in focal contacts.
• Conjugation: HIS
• Molecular Weight: 25.500kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS

Gene Information

• Gene Name: NUDT16L1 nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 [ Homo sapiens ]
• Official Symbol: NUDT16L1
• Synonyms: NUDT16L1; nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1; protein syndesmos; SDOS
• Gene ID: 84309
• mRNA Refseq: NM_001193452
• Protein Refseq: NP_001180381
• Uniprot ID: Q9BRJ7
• Chromosome Location: 16p13.3
• Pathway: Syndecan-4-mediated signaling events, organism-specific biosystem
• Function: hydrolase activity