Recombinant Human NUBP1

• Cat.No.: NUBP1-28429TH
• Product Overview: Recombinant fragment of Human NUBP1 with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PIIGVVENMSPFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
• Sequence Similarities: Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

Gene Information

• Gene Name: NUBP1 nucleotide binding protein 1 [ Homo sapiens ]
• Official Symbol: NUBP1
• Synonyms: NUBP1; nucleotide binding protein 1; NBP1, nucleotide binding protein 1 (E.coli MinD like) , nucleotide binding protein 1 (MinD homolog, E. coli); cytosolic Fe-S cluster assembly factor NUBP1
• Gene ID: 4682
• mRNA Refseq: NM_002484
• Protein Refseq: NP_002475
• MIM: 600280
• Uniprot ID: P53384
• Chromosome Location: 16p13.13
• Function: 4 iron, 4 sulfur cluster binding; ATP binding; iron-sulfur cluster binding; metal ion binding; nucleoside-triphosphatase activity