Recombinant Human NTNG1, His-tagged
Cat.No. : | NTNG1-155H |
Product Overview : | Recombinant Human Netrin-G1/NTNG1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His29-Ser409) of Human Netrin-G1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 29-409 a.a. |
Description : | Netrin-G1 (NTNG1) is a member of a conserved family of proteins that act as axon guidance cues during vertebrate nervous system development. Netrin-G1 contains one laminin EGF-like domain and one laminin N-terminal domain, Netrin-G1 is highly expressed in the thalamus, lowly in other tissue. Netrin-G1 localizes to the cell membrane. Netrin-G1 interacts with NGL1 and is glycosylated in the N-terminal. In addition, Netrin-G1 can promotesneurite outgrowth of both axons and dendrites. |
AA Sequence : | HYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMC61NNE CDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNI121VITFE SGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTE181EYSTGYT TNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLR241PAVGEIFVD ELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGK31CKKNYQGRPWS PGSYLPIPKGTANTCIPSISSIGTNVCDNELLHCQNGGTCHNNVRCLCP361AAYTGILCEKLRC EEAGSCGSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
IL15 R alpha-2203M | Active Recombinant Mouse IL15 R alpha protein, Fc-tagged | +Inquiry |
RHOF-1180H | Recombinant Human RHOF Protein, MYC/DDK-tagged | +Inquiry |
RMI1-1640H | Recombinant Human RMI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAFAH1B1-12307M | Recombinant Mouse PAFAH1B1 Protein | +Inquiry |
RFL28395OF | Recombinant Full Length Ostreid Herpesvirus 1 Uncharacterized Protein Orf36(Orf36) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
IgG-355S | Native Sheep IgG | +Inquiry |
COL2A1-13B | Native Bovine COL2A1 Protein | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR32-5787HCL | Recombinant Human GPR32 293 Cell Lysate | +Inquiry |
PRKD1-2851HCL | Recombinant Human PRKD1 293 Cell Lysate | +Inquiry |
ZNF74-2083HCL | Recombinant Human ZNF74 cell lysate | +Inquiry |
CTSH-001MCL | Recombinant Mouse CTSH cell lysate | +Inquiry |
CDH19-325HCL | Recombinant Human CDH19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NTNG1 Products
Required fields are marked with *
My Review for All NTNG1 Products
Required fields are marked with *
0
Inquiry Basket