Recombinant Human NT5E

Cat.No. : NT5E-27507TH
Product Overview : Recombinant fragment of Human CD73 with a proprietary tag; predicted MWt 52.18 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 238 amino acids
Description : The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 52.180kDa
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
Sequence Similarities : Belongs to the 5-nucleotidase family.
Gene Name NT5E 5-nucleotidase, ecto (CD73) [ Homo sapiens ]
Official Symbol NT5E
Synonyms NT5E; 5-nucleotidase, ecto (CD73); 5 nucleotidase (CD73) , NT5; 5-nucleotidase; CD73; eN; eNT;
Gene ID 4907
mRNA Refseq NM_001204813
Protein Refseq NP_001191742
MIM 129190
Uniprot ID P21589
Chromosome Location 6q14-q21
Pathway HIF-1-alpha transcription factor network, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem;
Function 5-nucleotidase activity; ferrous iron binding; hydrolase activity, acting on ester bonds; metal ion binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NT5E Products

Required fields are marked with *

My Review for All NT5E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon