Recombinant Human NT5E

• Cat.No.: NT5E-27507TH
• Product Overview: Recombinant fragment of Human CD73 with a proprietary tag; predicted MWt 52.18 kDa including the tag.

Specification

• Description: The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 238 amino acids
• Molecular Weight: 52.180kDa
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
• Sequence Similarities: Belongs to the 5-nucleotidase family.
• Tag: Non

Gene Information

• Gene Name: NT5E 5-nucleotidase, ecto (CD73) [ Homo sapiens ]
• Official Symbol: NT5E
• Synonyms: NT5E; 5-nucleotidase, ecto (CD73); 5 nucleotidase (CD73) , NT5; 5-nucleotidase; CD73; eN; eNT
• Gene ID: 4907
• mRNA Refseq: NM_001204813
• Protein Refseq: NP_001191742
• MIM: 129190
• Uniprot ID: P21589
• Chromosome Location: 6q14-q21
• Pathway: HIF-1-alpha transcription factor network, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem
• Function: 5-nucleotidase activity; ferrous iron binding; hydrolase activity, acting on ester bonds; metal ion binding; nucleotide binding