Recombinant Human NT5C2 Protein (Mutant), N-6×His-tagged

• Cat.No.: NT5C2-2490HM
• Product Overview: Recombinant Human NT5C2 Protein (Mutant) with N-6×His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides.
• Molecular Mass: ~67.7 kDa, reducing conditions
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLANLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHA KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDAAFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEEE
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.5 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM Tris-HCl buffer (pH8.0) containing 30 % glycerol 0.1M NaCl, 1mM DTT, 0.1mM PMSF.

Gene Information

• Gene Name: NT5C2 5'-nucleotidase, cytosolic II [ Homo sapiens (human) ]
• Official Symbol: NT5C2
• Synonyms: NT5C2; 5'-nucleotidase, cytosolic II; GMP; NT5B; PNT5; SPG45; SPG65; cN-II; cytosolic purine 5'-nucleotidase; 5'-nucleotidase (purine), cytosolic type B; IMP-specific 5'-NT; cytosolic IMP/GMP-specific 5'-nucleotidase; cytosolic nucleoside phosphotransferase 5'N; epididymis secretory sperm binding protein; high Km 5'-nucleotidase; spastic paraplegia 45 (autosomal recessive); EC 2.7.1.77; EC 3.1.3.5; EC 3.1.3.99
• Gene ID: 22978
• mRNA Refseq: NM_012229
• Protein Refseq: NP_036361
• MIM: 600417
• UniProt ID: P49902