Recombinant Human NRTN protein

• Cat.No.: NRTN-29535TH
• Product Overview: Recombinant Human NRTN protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 102
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 30 mM Citrate Sodium, pH 4.2, 400 mM NaCl, with 0.02 % Tween-20.
• Bio-activity: Fully biologically active when compared to standard. The biologically active as determined by its binding ability in a functional ELISA.
• Molecular Mass: Approximately 23.4 kDa, a homodimeric protein consisting of two 102 amino acid non-glycosylated polypeptide chains.
• AA Sequence: ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
• Endotoxin: Less than 1 EU/μg of rHuNeurturin as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.5 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: NRTN
• Official Symbol: NRTN
• Synonyms: NRTN; neurturin; NTN
• Gene ID: 4902
• mRNA Refseq: NM_004558
• Protein Refseq: NP_004549
• MIM: 602018
• UniProt ID: Q99748