Recombinant Human NRGN Protein, GST-tagged

• Cat.No.: NRGN-22H
• Product Overview: Human NRGN full-length ORF ( AAH02835, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ expression system.

Specification

• Species: Human
• Source: Wheat germ
• Tag: GST
• Description: Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
• Molecular Mass: 34.32 kDa
• AA Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NRGN neurogranin [ Homo sapiens (human) ]
• Official Symbol: NRGN
• Synonyms: NRGN; neurogranin; RC3; hng
• Gene ID: 4900
• mRNA Refseq: NM_006176
• Protein Refseq: NP_006167
• MIM: 602350
• UniProt ID: Q92686