Active Recombinant Full Length Human NRGN Protein, C-Flag-tagged
Cat.No. : | NRGN-113HFL |
Product Overview : | Recombinant Full Length Human NRGN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA standard |
Molecular Mass : | 7.4 kDa |
AA Sequence : | MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | NRGN neurogranin [ Homo sapiens (human) ] |
Official Symbol | NRGN |
Synonyms | RC3; hng |
Gene ID | 4900 |
mRNA Refseq | NM_006176.3 |
Protein Refseq | NP_006167.1 |
MIM | 602350 |
UniProt ID | Q92686 |
◆ Recombinant Proteins | ||
NRGN-2920R | Recombinant Rhesus Macaque NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-1547H | Recombinant Human NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-3740R | Recombinant Rat NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-6201M | Recombinant Mouse NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-4738H | Recombinant Human NRGN Protein (Met1-Ala67), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRGN-3696HCL | Recombinant Human NRGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRGN Products
Required fields are marked with *
My Review for All NRGN Products
Required fields are marked with *
0
Inquiry Basket