Recombinant Human NRG4 protein, GST-tagged

• Cat.No.: NRG4-1365H
• Product Overview: Recombinant Human NRG4 protein(1-62 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-62 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• AA Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NRG4
• Synonyms: NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944
• Gene ID: 145957
• mRNA Refseq: NM_138573
• Protein Refseq: NP_612640
• MIM: 610894
• UniProt ID: Q8WWG1