Recombinant Human NRG1 protein

Cat.No. : NRG1-16H
Product Overview : Recombinant Human NRG1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 65
Description : Neuregulin 1 belongs to a family of structurally related polypeptide growth factors and is produced in numerous isoforms by alternative splicing, which allows it to perform a wide variety of functions. These isoforms include heregulins (HRGs), glial growth factors (GGFs) and sensory and motor neuron-derived factor (SMDF). They all have the Ig and EGF-like domain, and can bind to ErbB3 and ErbB4 receptor tyrosin kinases. This binding induces ErbB3 and ErbB4 heterodimerization with ErbB2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. NRG1 isoforms have functions of inducing the growth and differentiation of epithelial, neuronal, glial, and other types of cells.
Form : Lyophilized from a 0.2μm filtered solution in 20 mM PB, pH 6.0, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg.
Molecular Mass : Approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 65 amino acids.
AA Sequence : SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
Endotoxin : Less than 0.1 EU/μg of rHuNRG1-α as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name NRG1
Official Symbol NRG1
Synonyms NRG1; neuregulin 1; HGL; pro-neuregulin-1, membrane-bound isoform; GGF; HRG; NDF; MSTP131; pro-NRG1; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); ARIA; GGF2; HRG1; HRGA; SMDF; MST131;
Gene ID 3084
mRNA Refseq NM_001159995
Protein Refseq NP_001153467
MIM 142445
UniProt ID Q02297

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NRG1 Products

Required fields are marked with *

My Review for All NRG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon