Recombinant Human NRBP1 Protein, GST-tagged

• Cat.No.: NRBP1-6109H
• Product Overview: Human NRBP partial ORF ( AAH01221, 436 a.a. - 535 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NRBP1 (Nuclear Receptor Binding Protein 1) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway. GO annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is NRBP2.
• Molecular Mass: 36.63 kDa
• AA Sequence: PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NRBP1 nuclear receptor binding protein 1 [ Homo sapiens ]
• Official Symbol: NRBP1
• Synonyms: NRBP1; nuclear receptor binding protein 1; NRBP, nuclear receptor binding protein; nuclear receptor-binding protein; BCON3; MADM; MUDPNP; multiple domain putative nuclear protein; myeloid leukemia factor 1 adaptor molecule; NRBP; FLJ27109; FLJ35541
• Gene ID: 29959
• mRNA Refseq: NM_013392
• Protein Refseq: NP_037524
• MIM: 606010
• UniProt ID: Q9UHY1