Recombinant Human NRAS Protein, GST-tagged

• Cat.No.: NRAS-6106H
• Product Overview: Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated to a GTP-bound form by a GTPase activating protein and inactivated to a GDP-bound form by a guanine nucleotide-exchange factor. Defects in this gene are a cause of juvenile myelomonocytic leukemia (JMML). [provided by RefSeq
• Molecular Mass: 47.6 kDa
• AA Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NRAS neuroblastoma RAS viral (v-ras) oncogene homolog [ Homo sapiens ]
• Official Symbol: NRAS
• Synonyms: NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1
• Gene ID: 4893
• mRNA Refseq: NM_002524
• Protein Refseq: NP_002515
• MIM: 164790
• UniProt ID: P01111