Recombinant Human NRAP Protein, GST-tagged

Cat.No. : NRAP-6104H
Product Overview : Human NRAP partial ORF ( NP_932326.2, 1640 a.a. - 1727 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NRAP (Nebulin Related Anchoring Protein) is a Protein Coding gene. GO annotations related to this gene include actin binding and muscle alpha-actinin binding. An important paralog of this gene is NEB.
Molecular Mass : 35.42 kDa
AA Sequence : LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NRAP nebulin related anchoring protein [ Homo sapiens (human) ]
Official Symbol NRAP
Synonyms NRAP; nebulin related anchoring protein; N-RAP; nebulin-related-anchoring protein;
Gene ID 4892
mRNA Refseq NM_001261463
Protein Refseq NP_001248392
MIM 602873
UniProt ID Q86VF7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NRAP Products

Required fields are marked with *

My Review for All NRAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon