Recombinant Human NRAP Protein, GST-tagged

• Cat.No.: NRAP-6104H
• Product Overview: Human NRAP partial ORF ( NP_932326.2, 1640 a.a. - 1727 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NRAP (Nebulin Related Anchoring Protein) is a Protein Coding gene. GO annotations related to this gene include actin binding and muscle alpha-actinin binding. An important paralog of this gene is NEB.
• Molecular Mass: 35.42 kDa
• AA Sequence: LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NRAP nebulin related anchoring protein [ Homo sapiens (human) ]
• Official Symbol: NRAP
• Synonyms: NRAP; nebulin related anchoring protein; N-RAP; nebulin-related-anchoring protein
• Gene ID: 4892
• mRNA Refseq: NM_001261463
• Protein Refseq: NP_001248392
• MIM: 602873
• UniProt ID: Q86VF7