Recombinant Human NR4A1 Protein, GST-tagged

• Cat.No.: NR4A1-6093H
• Product Overview: Human NR4A1 full-length ORF ( AAH16147, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
• Molecular Mass: 91.52 kDa
• AA Sequence: MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTRGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NR4A1 nuclear receptor subfamily 4, group A, member 1 [ Homo sapiens ]
• Official Symbol: NR4A1
• Synonyms: NR4A1; nuclear receptor subfamily 4, group A, member 1; GFRP1, HMR; nuclear receptor subfamily 4 group A member 1; N10; NAK 1; NGFIB; NUR77; TR3; ST-59; hormone receptor; TR3 orphan receptor; steroid receptor TR3; testicular receptor 3; early response protein NAK1; orphan nuclear receptor HMR; orphan nuclear receptor TR3; nuclear hormone receptor NUR/77; growth factor-inducible nuclear protein N10; nerve growth factor IB nuclear receptor variant 1; HMR; NP10; GFRP1; NAK-1; MGC9485
• Gene ID: 3164
• mRNA Refseq: NM_001202233
• Protein Refseq: NP_001189162
• MIM: 139139
• UniProt ID: P22736