Recombinant Human NR3C2 Protein, GST tagged

• Cat.No.: NR3C2-01H
• Product Overview: Recombinant Human NR3C2 Protein (604-984 aa) with GST tag was expressed in Baculovirus-Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: GST
• Protein Length: 604-984 aa
• Description: This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
• Source: Insect cells
• Species: Human
• Tag: GST
• Molecular Weight: 71 kDa
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.2, 10mM Glutathione
• Concentration: 0.21 mg/mL by Bradford

Gene Information

• Gene Name: NR3C2 nuclear receptor subfamily 3, group C, member 2 [ Homo sapiens (human) ]
• Official Symbol: NR3C2
• Synonyms: NR3C2; nuclear receptor subfamily 3, group C, member 2; MLR; mineralocorticoid receptor; MR; aldosterone receptor; mineralocorticoid receptor 1; mineralocorticoid receptor delta; MCR; NR3C2VIT; FLJ41052; MGC133092
• Gene ID: 4306
• mRNA Refseq: NM_000901
• Protein Refseq: NP_000892
• MIM: 600983
• UniProt ID: P08235