Recombinant Human NR3C1 protein, His-GST-tagged

• Cat.No.: NR3C1-3290H
• Product Overview: Recombinant Human NR3C1 protein(P04150)(521-777aa), fused to N-terminal His-GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 59.8 kDa
• Protein length: 521-777aa
• AA Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NR3C1 nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) [ Homo sapiens ]
• Official Symbol: NR3C1
• Synonyms: NR3C1; nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor); GRL, nuclear receptor subfamily 3, group C, member 1; glucocorticoid receptor; GR; glucocorticoid nuclear receptor variant 1; GCR; GRL; GCCR
• Gene ID: 2908
• mRNA Refseq: NM_000176
• Protein Refseq: NP_000167
• UniProt ID: P04150