Recombinant Human NR2F6 Protein, GST-tagged

• Cat.No.: NR2F6-6088H
• Product Overview: Human NR2F6 full-length ORF (BAG37465.1, 1 a.a. - 404 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NR2F6 (Nuclear Receptor Subfamily 2 Group F Member 6) is a Protein Coding gene. Among its related pathways are Nuclear Receptor transcription pathway and Circadian rythm related genes. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II distal enhancer sequence-specific DNA binding. An important paralog of this gene is NR2F2.
• Molecular Mass: 70.84 kDa
• AA Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NR2F6 nuclear receptor subfamily 2, group F, member 6 [ Homo sapiens ]
• Official Symbol: NR2F6
• Synonyms: NR2F6; nuclear receptor subfamily 2, group F, member 6; ERBAL2; nuclear receptor subfamily 2 group F member 6; EAR 2; ERBA-related gene-2; V-erbA-related protein 2; nuclear receptor V-erbA-related; v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2; EAR2; EAR-2
• Gene ID: 2063
• mRNA Refseq: NM_005234
• Protein Refseq: NP_005225
• MIM: 132880
• UniProt ID: P10588