Recombinant Human NR2C2AP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NR2C2AP-5708H
Product Overview : NR2C2AP MS Standard C13 and N15-labeled recombinant protein (NP_795361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NR2C2AP (Nuclear Receptor 2C2 Associated Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway.
Molecular Mass : 15.9 kDa
AA Sequence : MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NR2C2AP nuclear receptor 2C2-associated protein [ Homo sapiens (human) ]
Official Symbol NR2C2AP
Synonyms NR2C2AP; nuclear receptor 2C2-associated protein; TR4 orphan receptor associated protein TRA16; TRA16; repressor for TR4 transactivation; TR4 orphan receptor-associated 16 kDa protein;
Gene ID 126382
mRNA Refseq NM_176880
Protein Refseq NP_795361
MIM 608719
UniProt ID Q86WQ0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NR2C2AP Products

Required fields are marked with *

My Review for All NR2C2AP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon