Recombinant Human NR2C2AP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NR2C2AP-5708H
• Product Overview: NR2C2AP MS Standard C13 and N15-labeled recombinant protein (NP_795361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NR2C2AP (Nuclear Receptor 2C2 Associated Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway.
• Molecular Mass: 15.9 kDa
• AA Sequence: MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NR2C2AP nuclear receptor 2C2-associated protein [ Homo sapiens (human) ]
• Official Symbol: NR2C2AP
• Synonyms: NR2C2AP; nuclear receptor 2C2-associated protein; TR4 orphan receptor associated protein TRA16; TRA16; repressor for TR4 transactivation; TR4 orphan receptor-associated 16 kDa protein
• Gene ID: 126382
• mRNA Refseq: NM_176880
• Protein Refseq: NP_795361
• MIM: 608719
• UniProt ID: Q86WQ0