Recombinant Human NR2C2AP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NR2C2AP-5708H |
Product Overview : | NR2C2AP MS Standard C13 and N15-labeled recombinant protein (NP_795361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NR2C2AP (Nuclear Receptor 2C2 Associated Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway. |
Molecular Mass : | 15.9 kDa |
AA Sequence : | MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NR2C2AP nuclear receptor 2C2-associated protein [ Homo sapiens (human) ] |
Official Symbol | NR2C2AP |
Synonyms | NR2C2AP; nuclear receptor 2C2-associated protein; TR4 orphan receptor associated protein TRA16; TRA16; repressor for TR4 transactivation; TR4 orphan receptor-associated 16 kDa protein; |
Gene ID | 126382 |
mRNA Refseq | NM_176880 |
Protein Refseq | NP_795361 |
MIM | 608719 |
UniProt ID | Q86WQ0 |
◆ Recombinant Proteins | ||
NR2C2AP-5708H | Recombinant Human NR2C2AP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NR2C2AP-10863M | Recombinant Mouse NR2C2AP Protein | +Inquiry |
NR2C2AP-6185M | Recombinant Mouse NR2C2AP Protein, His (Fc)-Avi-tagged | +Inquiry |
NR2C2AP-4312Z | Recombinant Zebrafish NR2C2AP | +Inquiry |
NR2C2AP-1357H | Recombinant Human NR2C2AP, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2C2AP-3712HCL | Recombinant Human NR2C2AP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR2C2AP Products
Required fields are marked with *
My Review for All NR2C2AP Products
Required fields are marked with *
0
Inquiry Basket