Recombinant Human NPR3

• Cat.No.: NPR3-27852TH
• Product Overview: Recombinant fragment corresponding to amino acids 42-140 of Human Natriuretic Peptide Receptor C with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Description: This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of this gene encodes a natriuretic peptide receptor responsible for clearing circulating and extracellular natriuretic peptides through endocytosis of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
• Sequence Similarities: Belongs to the ANF receptor family.
• Tag: Non

Gene Information

• Gene Name: NPR3 natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) [ Homo sapiens ]
• Official Symbol: NPR3
• Synonyms: NPR3; natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C); ANPRC, C5orf23, chromosome 5 open reading frame 23 , NPRC; atrial natriuretic peptide receptor 3; FLJ14054; GUCY2B
• Gene ID: 4883
• mRNA Refseq: NM_000908
• Protein Refseq: NP_000899
• MIM: 108962
• Uniprot ID: P17342
• Chromosome Location: 5p14-p13
• Function: hormone binding; natriuretic peptide receptor activity; receptor activity