Recombinant Human NPR1 Protein, GST-tagged

• Cat.No.: NPR1-6043H
• Product Overview: Human NPR1 partial ORF ( AAH63304, 147 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ]
• Official Symbol: NPR1
• Synonyms: NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A; GC-A; ANP-A; NPR-A; ANPR-A; guanylate cyclase A; natriuretic peptide receptor A; atrionatriuretic peptide receptor A; natriuretic peptide A type receptor; atrial natriuretic peptide receptor type A; NPRA; ANPRA; GUC2A
• Gene ID: 4881
• mRNA Refseq: NM_000906
• Protein Refseq: NP_000897
• MIM: 108960
• UniProt ID: P16066