Recombinant Human NPR1 Protein, GST-tagged

Cat.No. : NPR1-6043H
Product Overview : Human NPR1 partial ORF ( AAH63304, 147 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ]
Official Symbol NPR1
Synonyms NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A; GC-A; ANP-A; NPR-A; ANPR-A; guanylate cyclase A; natriuretic peptide receptor A; atrionatriuretic peptide receptor A; natriuretic peptide A type receptor; atrial natriuretic peptide receptor type A; NPRA; ANPRA; GUC2A;
Gene ID 4881
mRNA Refseq NM_000906
Protein Refseq NP_000897
MIM 108960
UniProt ID P16066

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NPR1 Products

Required fields are marked with *

My Review for All NPR1 Products

Required fields are marked with *

0

Inquiry Basket

There is no product in the inquiry basket.

cartIcon