Recombinant Human NPIP Protein, GST-tagged
Cat.No. : | NPIP-6033H |
Product Overview : | Human NPIP partial ORF ( NP_008916, 97 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NPIPB11 (Nuclear Pore Complex Interacting Protein Family Member B11) is a Protein Coding gene. An important paralog of this gene is NPIPB4. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPIP nuclear pore complex interacting protein [ Homo sapiens ] |
Official Symbol | NPIP |
Synonyms | NPIP; nuclear pore complex interacting protein; nuclear pore complex-interacting protein; morpheus; FLJ42525; FLJ44848; |
Gene ID | 9284 |
mRNA Refseq | NM_006985 |
Protein Refseq | NP_008916 |
MIM | 606406 |
UniProt ID | Q9UND3 |
◆ Recombinant Proteins | ||
NPIP-6033H | Recombinant Human NPIP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPIP Products
Required fields are marked with *
My Review for All NPIP Products
Required fields are marked with *
0
Inquiry Basket