Recombinant Human NPHS1 protein(1131-1220 aa), C-His-tagged

• Cat.No.: NPHS1-2474H
• Product Overview: Recombinant Human NPHS1 protein(O60500)(1131-1220 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1131-1220 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: STTEAEPYYRSLRDFSPQLPPTQEEVSYSRGFTGEDEDMAFPGHLYDEVERTYPPSGAWGPLYDEVQMGPWDLHWPEDTYQDPRGIYDQV

Gene Information

• Gene Name: NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
• Official Symbol: NPHS1
• Synonyms: NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor
• Gene ID: 4868
• mRNA Refseq: NM_004646
• Protein Refseq: NP_004637
• MIM: 602716
• UniProt ID: O60500