Recombinant Human NPHP3 Protein, GST-tagged

• Cat.No.: NPHP3-6028H
• Product Overview: Human NPHP3 partial ORF ( NP_694972.3, 106 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein containing a coiled-coil (CC) domain, a tubulin-tyrosine ligase (TTL) domain, and a tetratrico peptide repeat (TPR) domain. The encoded protein interacts with nephrocystin and may function in renal tubular development and function. Mutations in this gene are associated with nephronophthisis type 3. Multiple splice variants have been described but their full-length nature has not been determined. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: NQELLSMGRREAKLDTENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPHP3 nephronophthisis 3 (adolescent) [ Homo sapiens (human) ]
• Official Symbol: NPHP3
• Synonyms: NPHP3; MKS7; NPH3; RHPD; RHPD1; nephronophthisis 3 (adolescent); nephrocystin-3; Meckel syndrome, type 7
• Gene ID: 27031
• mRNA Refseq: NM_153240
• Protein Refseq: NP_694972
• MIM: 608002
• UniProt ID: Q7Z494