Recombinant Human NPHP3 Protein, GST-tagged

Cat.No. : NPHP3-6028H
Product Overview : Human NPHP3 partial ORF ( NP_694972.3, 106 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing a coiled-coil (CC) domain, a tubulin-tyrosine ligase (TTL) domain, and a tetratrico peptide repeat (TPR) domain. The encoded protein interacts with nephrocystin and may function in renal tubular development and function. Mutations in this gene are associated with nephronophthisis type 3. Multiple splice variants have been described but their full-length nature has not been determined. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : NQELLSMGRREAKLDTENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPHP3 nephronophthisis 3 (adolescent) [ Homo sapiens (human) ]
Official Symbol NPHP3
Synonyms NPHP3; MKS7; NPH3; RHPD; RHPD1; nephronophthisis 3 (adolescent); nephrocystin-3; Meckel syndrome, type 7
Gene ID 27031
mRNA Refseq NM_153240
Protein Refseq NP_694972
MIM 608002
UniProt ID Q7Z494

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NPHP3 Products

Required fields are marked with *

My Review for All NPHP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon