Recombinant Human NPHP3 Protein, GST-tagged
Cat.No. : | NPHP3-6028H |
Product Overview : | Human NPHP3 partial ORF ( NP_694972.3, 106 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein containing a coiled-coil (CC) domain, a tubulin-tyrosine ligase (TTL) domain, and a tetratrico peptide repeat (TPR) domain. The encoded protein interacts with nephrocystin and may function in renal tubular development and function. Mutations in this gene are associated with nephronophthisis type 3. Multiple splice variants have been described but their full-length nature has not been determined. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NQELLSMGRREAKLDTENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPHP3 nephronophthisis 3 (adolescent) [ Homo sapiens (human) ] |
Official Symbol | NPHP3 |
Synonyms | NPHP3; MKS7; NPH3; RHPD; RHPD1; nephronophthisis 3 (adolescent); nephrocystin-3; Meckel syndrome, type 7 |
Gene ID | 27031 |
mRNA Refseq | NM_153240 |
Protein Refseq | NP_694972 |
MIM | 608002 |
UniProt ID | Q7Z494 |
◆ Recombinant Proteins | ||
NPHP3-1809H | Recombinant Human NPHP3 protein, GST-tagged | +Inquiry |
NPHP3-1342H | Recombinant Human NPHP3, His-tagged | +Inquiry |
NPHP3-3663H | Recombinant Human NPHP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPHP3-6158M | Recombinant Mouse NPHP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPHP3-6028H | Recombinant Human NPHP3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPHP3 Products
Required fields are marked with *
My Review for All NPHP3 Products
Required fields are marked with *
0
Inquiry Basket