Recombinant Human NPHP1 Protein (1-109 aa), GST-tagged

• Cat.No.: NPHP1-688H
• Product Overview: Recombinant Human NPHP1 Protein (1-109 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-109 aa
• Description: Together with BCAR1 it may play a role in the control of epithelial cell polarity. Involved in the organization of apical junctions in kidney cells together with NPHP4 and RPGRIP1L/NPHP8 . Does not se to be strictly required for ciliogenesis . Ses to help to recruit PTK2B/PYK2 to cell matrix adhesions, thereby initiating phosphorylation of PTK2B/PYK2 and PTK2B/PYK2-dependent signaling. May play a role in the regulation of intraflagellar transport (IFT) during cilia assbly. Required for normal retina development. In connecting photoreceptor cilia influences the movent of some IFT proteins such as IFT88 and WDR19. Involved in spermatogenesis.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.7 kDa
• AA Sequence: MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENIT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NPHP1 nephronophthisis 1 (juvenile) [ Homo sapiens ]
• Official Symbol: NPHP1
• Synonyms: NPHP1; NPH1; nephrocystin-1; JBTS4; nephrocystin 1; SLSN1; FLJ97602
• Gene ID: 4867
• mRNA Refseq: NM_000272
• Protein Refseq: NP_000263
• MIM: 607100
• UniProt ID: O15259