Description :	The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
Conjugation :	HIS
Source :	E. coli
Tissue specificity :	Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.
Form :	Liquid
Purity :	>90% by SDS-PAGE
Storage buffer :	Preservative: NoneConstituents: 1X PBS
Storage :	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids :	KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Sequence Similarities :	Belongs to the CCN family.Contains 1 CTCK (C-terminal cystine knot-like) domain.Contains 1 IGFBP N-terminal domain.Contains 1 TSP type-1 domain.Contains 1 VWFC domain.
Protein length :	260-357 a.a.

Gene Name	NOV nephroblastoma overexpressed gene [ Homo sapiens ]
Official Symbol	NOV
Synonyms	NOV; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9;
Gene ID	4856
mRNA Refseq	NM_002514
Protein Refseq	NP_002505
MIM	164958
Uniprot ID	P48745
Chromosome Location	8q24.12
Pathway	Delta-Notch Signaling Pathway, organism-specific biosystem;
Function	growth factor activity; insulin-like growth factor binding;

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	NOV-27805TH
Product Overview :	Recombinant fragment: KGKKCLRTKK SLKAIHLQFK NCTSLHTYKP RFCGVCSDGR CCTPHNTKTI QAEFQCSPGQ IVKKPVMVIG TCTCHTNCPK NNEAFLQELE LKTTRGKM, corresponding to amino acids 260-357 of Human CCN3, fused to His tag, 18kDa.

Recombinant Human NOV, His-tagged