Recombinant Human NOV protein

Cat.No. : NOV-27832TH
Product Overview : Recombinant Human NOV protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 331
Description : The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.6, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
Molecular Mass : Approximately 36.2 kDa, a single non-glycosylated polypeptide chain containing 331 amino acids.
AA Sequence : MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Endotoxin : Less than 0.1 EU/μg of rHuNOV as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name NOV
Official Symbol NOV
Synonyms NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP-9; IGFBP-9;
Gene ID 4856
mRNA Refseq NM_002514
Protein Refseq NP_002505
MIM 164958
UniProt ID P48745

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOV Products

Required fields are marked with *

My Review for All NOV Products

Required fields are marked with *

0

Inquiry Basket

cartIcon