Recombinant Human NOV protein
Cat.No. : | NOV-27832TH |
Product Overview : | Recombinant Human NOV protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 331 |
Description : | The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.6, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
Molecular Mass : | Approximately 36.2 kDa, a single non-glycosylated polypeptide chain containing 331 amino acids. |
AA Sequence : | MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
Endotoxin : | Less than 0.1 EU/μg of rHuNOV as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | NOV |
Official Symbol | NOV |
Synonyms | NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP-9; IGFBP-9; |
Gene ID | 4856 |
mRNA Refseq | NM_002514 |
Protein Refseq | NP_002505 |
MIM | 164958 |
UniProt ID | P48745 |
◆ Recombinant Proteins | ||
NOV-3073R | Recombinant Rhesus monkey NOV Protein, His-tagged | +Inquiry |
NOV-6820C | Recombinant Chicken NOV | +Inquiry |
Nov-435R | Recombinant Rat Nov Protein, His-tagged | +Inquiry |
NOV-3688R | Recombinant Rat NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
NOV-219C | Recombinant Canine NOV, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOV-001CCL | Recombinant Cynomolgus NOV cell lysate | +Inquiry |
NOV-694HCL | Recombinant Human NOV cell lysate | +Inquiry |
NOV-897CCL | Recombinant Canine NOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOV Products
Required fields are marked with *
My Review for All NOV Products
Required fields are marked with *
0
Inquiry Basket