Recombinant Human NOTCH3 Protein, GST-tagged

• Cat.No.: NOTCH3-5999H
• Product Overview: Human NOTCH3 partial ORF ( NP_000426, 47 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOTCH3 notch 3 [ Homo sapiens ]
• Official Symbol: NOTCH3
• Synonyms: NOTCH3; notch 3; CADASIL, Notch (Drosophila) homolog 3 , Notch homolog 3 (Drosophila); neurogenic locus notch homolog protein 3; CASIL; Notch homolog 3; CADASIL
• Gene ID: 4854
• mRNA Refseq: NM_000435
• Protein Refseq: NP_000426
• MIM: 600276
• UniProt ID: Q9UM47