Recombinant Human NOS1 protein(231-310 aa), C-His-tagged
Cat.No. : | NOS1-2714H |
Product Overview : | Recombinant Human NOS1 protein(P29475)(231-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 231-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPSKCPRFLKVKN |
Gene Name | NOS1 nitric oxide synthase 1 (neuronal) [ Homo sapiens ] |
Official Symbol | NOS1 |
Synonyms | NOS1; nitric oxide synthase 1 (neuronal); NOS; nitric oxide synthase, brain; nNOS; NOS type I; neuronal NOS; constitutive NOS; peptidyl-cysteine S-nitrosylase NOS1; bNOS; IHPS1; N-NOS; NC-NOS; |
Gene ID | 4842 |
mRNA Refseq | NM_000620 |
Protein Refseq | NP_000611 |
MIM | 163731 |
UniProt ID | P29475 |
◆ Recombinant Proteins | ||
Nos1-7738M | Recombinant Mouse Nos1 protein, His-tagged | +Inquiry |
NOS1-4022R | Recombinant Rat NOS1 Protein | +Inquiry |
NOS1-2714H | Recombinant Human NOS1 protein(231-310 aa), C-His-tagged | +Inquiry |
Nos1-7737M | Recombinant Mouse Nos1 protein, His-tagged | +Inquiry |
NOS1-16H | Active Recombinant Human NOS1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS1-3761HCL | Recombinant Human NOS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOS1 Products
Required fields are marked with *
My Review for All NOS1 Products
Required fields are marked with *
0
Inquiry Basket