Recombinant Human NOS1 Protein, GST-tagged
Cat.No. : | NOS1-5989H |
Product Overview : | Human NOS1 partial ORF ( NP_000611, 1041 a.a. - 1150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. This gene encodes a nitric oxide synthase which is highly expressed in skeletal muscle. Genetic variations in this gene are associated with infantile hypertrophic pyloric stenosis type 1 |
Molecular Mass : | 37.84 kDa |
AA Sequence : | FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOS1 nitric oxide synthase 1 (neuronal) [ Homo sapiens ] |
Official Symbol | NOS1 |
Synonyms | NOS1; nitric oxide synthase 1 (neuronal); NOS; nitric oxide synthase, brain; nNOS; NOS type I; neuronal NOS; constitutive NOS; peptidyl-cysteine S-nitrosylase NOS1; bNOS; IHPS1; N-NOS; NC-NOS; |
Gene ID | 4842 |
mRNA Refseq | NM_000620 |
Protein Refseq | NP_000611 |
MIM | 163731 |
UniProt ID | P29475 |
◆ Recombinant Proteins | ||
NOS1-9191Z | Recombinant Zebrafish NOS1 | +Inquiry |
Nos1-7741R | Recombinant Rat Nos1 protein, His-tagged | +Inquiry |
NOS1-1524H | Recombinant Human NOS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOS1-7736H | Recombinant Human NOS1 protein, His-tagged | +Inquiry |
NOS1-4022R | Recombinant Rat NOS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS1-3761HCL | Recombinant Human NOS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOS1 Products
Required fields are marked with *
My Review for All NOS1 Products
Required fields are marked with *
0
Inquiry Basket