Recombinant Human NOS1 Protein, GST-tagged

• Cat.No.: NOS1-5989H
• Product Overview: Human NOS1 partial ORF ( NP_000611, 1041 a.a. - 1150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. This gene encodes a nitric oxide synthase which is highly expressed in skeletal muscle. Genetic variations in this gene are associated with infantile hypertrophic pyloric stenosis type 1
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOS1 nitric oxide synthase 1 (neuronal) [ Homo sapiens ]
• Official Symbol: NOS1
• Synonyms: NOS1; nitric oxide synthase 1 (neuronal); NOS; nitric oxide synthase, brain; nNOS; NOS type I; neuronal NOS; constitutive NOS; peptidyl-cysteine S-nitrosylase NOS1; bNOS; IHPS1; N-NOS; NC-NOS
• Gene ID: 4842
• mRNA Refseq: NM_000620
• Protein Refseq: NP_000611
• MIM: 163731
• UniProt ID: P29475