Recombinant Human NONO Protein, His tagged, Avi-Biotinylated

• Cat.No.: NONO-2497H
• Product Overview: Avi-Biotinylated Recombinant Human NONO Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
• Molecular Mass: The protein has a calculated MW of 26 kDa.
• AA Sequence: MHHHHHHGLNDIFEAQKIEWHEKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMD
• Endotoxin: < 10 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.15 mg/mL
• Storage Buffer: Sterile 50 mM Tris, pH7.5, 300 mM NaCl, 10% Glycerol

Gene Information

• Gene Name: NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
• Official Symbol: NONO
• Synonyms: NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein
• Gene ID: 4841
• mRNA Refseq: NM_001145408
• Protein Refseq: NP_001138880
• MIM: 300084
• UniProt ID: Q15233