Recombinant Human NOL4L protein, GST-tagged

• Cat.No.: NOL4L-7343H
• Product Overview: Recombinant Human NOL4L protein(40-166 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 40-166 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: NOL4L nucleolar protein 4 like [ Homo sapiens (human) ]
• Official Symbol: NOL4L
• Synonyms: C20orf112; C20orf113; NOL4L
• Gene ID: 140688
• mRNA Refseq: NM_001256798
• Protein Refseq: NP_001243727
• MIM: 618893