Recombinant Human NOG, StrepII-tagged

• Cat.No.: NOG-223H
• Product Overview: Purified, full-length human recombinant Noggin (NOG) protein (amino acids 28-232, 205 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23 kDa. (Accession NP_005441.1; UniProt Q13253)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 28-232, 205 a.a.
• Description: NOG binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). It is a member of noggin family.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLA ELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGS CFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: NOG noggin [ Homo sapiens ]
• Official Symbol: NOG
• Synonyms: NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1
• Gene ID: 9241
• mRNA Refseq: NM_005450
• Protein Refseq: NP_005441
• MIM: 602991
• UniProt ID: Q13253
• Chromosome Location: 17q22
• Pathway: BMP receptor signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: cytokine binding; protein complex binding; protein homodimerization activity