Recombinant Human NOD1 Protein, GST-Tagged

• Cat.No.: NOD1-1318H
• Product Overview: Human NOD1 partial ORF (AAH40339, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the NOD (nucleotide-binding oligomerization domain) family. This member is a cytosolic protein. It contains an N-terminal caspase recruitment domain (CARD), a centrally located nucleotide-binding domain (NBD), and 10 tandem leucine-rich repeats (LRRs) in its C terminus. The CARD is involved in apoptotic signaling, LRRs participate in protein-protein interactions, and mutations in the NBD may affect the process of oligomerization and subsequent function of the LRR domain. This protein is an intracellular pattern-recognition receptor (PRR) that initiates inflammation in response to a subset of bacteria through the detection of bacterial diaminopimelic acid. Multiple alternatively spliced transcript variants differring in the 5' UTR have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Oct 2009]
• Molecular Mass: 36.63 kDa
• AA Sequence: QQLADAYVDLRPWLLEIGFSPSLLTQSKVVVNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSLACLLDHTTGI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOD1 nucleotide-binding oligomerization domain containing 1 [ Homo sapiens ]
• Official Symbol: NOD1
• Synonyms: NOD1; nucleotide-binding oligomerization domain containing 1; CARD4, caspase recruitment domain family, member 4; nucleotide-binding oligomerization domain-containing protein 1; CLR7.1; NLR family; CARD domain containing 1; NLRC1; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 1; NLR family, CARD domain containing 1; caspase recruitment domain family, member 4; caspase recruitment domain-containing protein 4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 1; CARD4
• Gene ID: 10392
• mRNA Refseq: NM_006092
• Protein Refseq: NP_006083
• MIM: 605980
• UniProt ID: Q9Y239