Recombinant Human NME7, GST-tagged

• Cat.No.: NME7-49H
• Product Overview: Recombinant Human NME7(277 a.a. - 374 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Molecular Mass: 36.52 kDa
• AA Sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQ NAVHCTDLPEDGLLEVQYFFKIL
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) [Homo sapiens]
• Official Symbol: NME7
• Synonyms: NME7; NME/NM23 family member 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); EC 2.7.4.6; FLJ37194; MN23H7; NDK 7; nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; nm23-H7; OTTHUMP00000032536; OTTHUMP00000231077; OTTHUMP00000231078
• Gene ID: 29922
• mRNA Refseq: NM_013330
• Protein Refseq: NP_037462
• MIM: 613465
• UniProt ID: Q9Y5B8
• Chromosome Location: 1q24
• Pathway: Adenine ribonucleotide biosynthesis, IMP =>ADP,ATP; Purine metabolism; Pyrimidine ribonucleotide biosynthesis, UMP =>UDP/UTP,CDP/CTP
• Function: ATP binding; metal ion binding; nucleoside diphosphate kinase activity