Recombinant Human NME4 Protein, GST-tagged
Cat.No. : | NME4-5930H |
Product Overview : | Human NME4 full-length ORF ( NP_005000.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ] |
Official Symbol | NME4 |
Synonyms | NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; NDPK-D; nm23-H4; |
Gene ID | 4833 |
mRNA Refseq | NM_005009 |
Protein Refseq | NP_005000 |
MIM | 601818 |
UniProt ID | O00746 |
◆ Recombinant Proteins | ||
NME4-5441C | Recombinant Chicken NME4 | +Inquiry |
NME4-4713H | Recombinant Human NME4 Protein (Thr67-His185), N-His tagged | +Inquiry |
NME4-2875R | Recombinant Rhesus Macaque NME4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NME4-11412Z | Recombinant Zebrafish NME4 | +Inquiry |
NME4-5930H | Recombinant Human NME4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME4-3789HCL | Recombinant Human NME4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME4 Products
Required fields are marked with *
My Review for All NME4 Products
Required fields are marked with *
0
Inquiry Basket