Recombinant Human NLGN4X, His-tagged

Cat.No. : NLGN4X-158H
Product Overview : Recombinant Human Neuroligin 4, X-Linked/NLGN4X is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln42-Ser676) of Human NLGN4X fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Neuroligin 4, X-Linked (NLGN4X) is a single-pass type I membrane protein that belongs to the type-B carboxylesterase/lipase family. NLGN4X is detected at higher levels in heart and at lower levels in the liver, skeletal muscle, and pancreas. NLGN4X is a putative neuronal cell surface protein involved in cell-cell-interactions. NLGN4X may act as splice site-specific ligands for β-neurexins. It has been shown that NLGN4X is involved in the formation and remodeling of central nervous system synapses. NLGN4X also interacts with discs, large (Drosophila) homolog 4 (DLG4). Defects in NLGN4X have been associated with autism and Asperger syndrome.
AA Sequence : QAQYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQF AAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVY IHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEE NVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILA DKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYD IMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKE NPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYV FGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSK YNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTR RSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name NLGN4X neuroligin 4, X-linked [ Homo sapiens ]
Official Symbol NLGN4X
Synonyms NLGN4X; neuroligin 4, X-linked; neuroligin 4 , NLGN4; neuroligin-4, X-linked; HLNX; KIAA1260; NLGN; neuroligin X; HNLX; HNL4X; NLGN4; ASPGX2; AUTSX2; MGC22376;
Gene ID 57502
mRNA Refseq NM_020742
Protein Refseq NP_065793
MIM 300427
UniProt ID Q8N0W4
Chromosome Location Xp22.33
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function NOT carboxylesterase activity; chloride ion binding; neurexin family protein binding; neurexin family protein binding; protein binding; protein homodimerization activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NLGN4X Products

Required fields are marked with *

My Review for All NLGN4X Products

Required fields are marked with *

0

Inquiry Basket

cartIcon