Recombinant Human NLGN4X Protein, GST-tagged

• Cat.No.: NLGN4X-5913H
• Product Overview: Human NLGN4X partial ORF ( NP_065793, 577 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: RVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NLGN4X neuroligin 4, X-linked [ Homo sapiens ]
• Official Symbol: NLGN4X
• Synonyms: NLGN4X; neuroligin 4, X-linked; neuroligin 4 , NLGN4; neuroligin-4, X-linked; HLNX; KIAA1260; NLGN; neuroligin X; HNLX; HNL4X; NLGN4; ASPGX2; AUTSX2; MGC22376
• Gene ID: 57502
• mRNA Refseq: NM_020742
• Protein Refseq: NP_065793
• MIM: 300427
• UniProt ID: Q8N0W4