Recombinant Human Nkx3-2 Protein, His/MYC-tagged
Cat.No. : | Nkx3-2-1295H |
Product Overview : | Recombinant Human Nkx3-2 Protein (143-800aa) was expressed in E. coli with N-terminal His/MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 53.7 kDa/40.2 kDa/35.2 kDa |
AA Sequence : | MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | NKX3-2 NK3 homeobox 2 [ Homo sapiens ] |
Official Symbol | Nkx3-2 |
Synonyms | Nkx3-2; SMMD; BAPX1; NKX3B; NKX3.2 |
Gene ID | 579 |
mRNA Refseq | NM_001189.3 |
Protein Refseq | NP_001180.1 |
MIM | 602183 |
UniProt ID | P78367 |
◆ Recombinant Proteins | ||
SH3GL1-2104H | Recombinant Human SH3GL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RASGRP1-13953M | Recombinant Mouse RASGRP1 Protein | +Inquiry |
KDM5B-8595M | Recombinant Mouse KDM5B Protein | +Inquiry |
GLRX-5205H | Recombinant Human GLRX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YAAA-2305B | Recombinant Bacillus subtilis YAAA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
LukAB-733S | Native S. aureus LukA-LukB heterodimer Protein | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
PROC-269B | Active Native Bovine Protein C | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPC-5449HCL | Recombinant Human HNRNPC 293 Cell Lysate | +Inquiry |
HS3ST3A1-817HCL | Recombinant Human HS3ST3A1 cell lysate | +Inquiry |
MIPEP-4310HCL | Recombinant Human MIPEP 293 Cell Lysate | +Inquiry |
MLST8-4288HCL | Recombinant Human MLST8 293 Cell Lysate | +Inquiry |
NTRK1-963CCL | Recombinant Canine NTRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Nkx3-2 Products
Required fields are marked with *
My Review for All Nkx3-2 Products
Required fields are marked with *
0
Inquiry Basket