Recombinant Human NKX2-3 Protein, GST-tagged

Description :	NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	58.9 kDa
AA Sequence :	MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAGPPRRPLPCSPPAARPEAAPL
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Protein length :	1-293 a.a.

Gene Name	NKX2-3 NK2 homeobox 3 [ Homo sapiens ]
Official Symbol	NKX2-3
Synonyms	NKX2-3; NK2 homeobox 3; NK 2 (Drosophila) homolog C , NK2 transcription factor related, locus 3 (Drosophila) , NKX2C; homeobox protein Nkx-2.3; CSX3; NKX2.3; NKX4 3; homeobox protein NK-2 homolog C; NK2 transcription factor related, locus 3; NK2.3; NKX2C; NKX4-3;
Gene ID	159296
mRNA Refseq	NM_145285
Protein Refseq	NP_660328
MIM	606727
UniProt ID	Q8TAU0