Recombinant Human NKX2-1 protein, His&Myc-tagged

• Cat.No.: NKX2-1-3277H
• Product Overview: Recombinant Human NKX2-1 protein(P43699)(1-371aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 1-371aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.0 kDa
• AA Sequence: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NKX2-1 NK2 homeobox 1 [ Homo sapiens ]
• Official Symbol: NKX2-1
• Synonyms: NKX2-1; NK2 homeobox 1; BCH, benign chorea , NKX2A, thyroid transcription factor 1 , TITF1; homeobox protein Nkx-2.1; TTF 1; TTF1; NK-2 homolog A; thyroid nuclear factor 1; thyroid transcription factor 1; homeobox protein NK-2 homolog A; BCH; BHC; NK-2; TEBP; NKX2A; TITF1; TTF-1; NKX2.1
• Gene ID: 7080
• mRNA Refseq: NM_001079668
• Protein Refseq: NP_001073136
• MIM: 600635
• UniProt ID: P43699