Recombinant Human NKX2-1 protein, His&Myc-tagged

Cat.No. : NKX2-1-3277H
Product Overview : Recombinant Human NKX2-1 protein(P43699)(1-371aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-371aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 46.0 kDa
AA Sequence : MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NKX2-1 NK2 homeobox 1 [ Homo sapiens ]
Official Symbol NKX2-1
Synonyms NKX2-1; NK2 homeobox 1; BCH, benign chorea , NKX2A, thyroid transcription factor 1 , TITF1; homeobox protein Nkx-2.1; TTF 1; TTF1; NK-2 homolog A; thyroid nuclear factor 1; thyroid transcription factor 1; homeobox protein NK-2 homolog A; BCH; BHC; NK-2; TEBP; NKX2A; TITF1; TTF-1; NKX2.1;
Gene ID 7080
mRNA Refseq NM_001079668
Protein Refseq NP_001073136
MIM 600635
UniProt ID P43699

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NKX2-1 Products

Required fields are marked with *

My Review for All NKX2-1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon