Recombinant Human NIPSNAP1 Protein, GST-tagged

• Cat.No.: NIPSNAP1-5874H
• Product Overview: Human NIPSNAP1 full-length ORF ( AAH02371.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq
• Molecular Mass: 59.7 kDa
• AA Sequence: MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NIPSNAP1 nipsnap homolog 1 (C. elegans) [ Homo sapiens ]
• Official Symbol: NIPSNAP1
• Synonyms: NIPSNAP1; nipsnap homolog 1 (C. elegans); protein NipSnap homolog 1; 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1
• Gene ID: 8508
• mRNA Refseq: NM_001202502
• Protein Refseq: NP_001189431