Recombinant Human NIPAL4 Protein

• Cat.No.: NIPAL4-5871H
• Product Overview: Human NIPAL4 full-length ORF (AAI60182.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis. [provided by RefSeq, Feb 2010]
• Form: Liquid
• Molecular Mass: 51.3 kDa
• AA Sequence: MPGDSSPGTLPLWDASLSPPLGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAPGPMELRVSNTSCENGSLLHLYCSSQEVLCQIVNDLSPEVPSNATFHSWQERIRQNYGFYIGLGLAFLSSFLIGSSVILKKKGLLRLVATGATRAVDGGFGYLKDAMWWAGFLTMAAGEVANFGAYAFAPATVVTPLGALSVLISAILSSYFLRESLNLLGKLGCVICVAGSTVMVIHAPEEEKVTTIMEMASKMKDTGFIVFAVLLLVSCLILIFVIAPRYGQRNILIYIIICSVIGAFSVAAVKGLGITIKNFFQGLPVVRHPLPYILSLILALSLSTQVNFLNRALDIFNTSLVFPIYYVFFTTVVVTSSIILFKEWYSMSAVDIAGTLSGFVTIILGVFMLHAFKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: NIPAL4 NIPA-like domain containing 4 [ Homo sapiens ]
• Official Symbol: NIPAL4
• Synonyms: NIPAL4; NIPA-like domain containing 4; NIPA like 4; magnesium transporter NIPA4; ichthyin; ICHYN; NIPA-like protein 4; non-imprinted in Prader-Willi/Angelman syndrome region protein 4; ICHTHYIN
• Gene ID: 348938
• mRNA Refseq: NM_001099287
• Protein Refseq: NP_001092757
• MIM: 609383
• UniProt ID: Q0D2K0